PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013584656.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 334aa    MW: 37473.7 Da    PI: 8.06
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013584656.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++ +G g+W+++++  g+ R++k+c++rw +yl
   XP_013584656.1 14 KGLWSPEEDEKLLNYITNHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding46.39.8e-1567109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg++++eE+ l+++++  lG++ W+ Ia++++ gRt++++k+ w+
   XP_013584656.1  67 RGAFSPEEENLIAELHSVLGNR-WSQIAARLP-GRTDNEIKNLWN 109
                      89********************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-27664IPR009057Homeodomain-like
PROSITE profilePS5129424.478965IPR017930Myb domain
SuperFamilySSF466894.12E-2912108IPR009057Homeodomain-like
SMARTSM007172.9E-121363IPR001005SANT/Myb domain
PfamPF002499.7E-161461IPR001005SANT/Myb domain
CDDcd001675.01E-111761No hitNo description
Gene3DG3DSA:1.10.10.606.3E-2565116IPR009057Homeodomain-like
SMARTSM007171.3E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129419.08166116IPR017930Myb domain
PfamPF002497.6E-1467109IPR001005SANT/Myb domain
CDDcd001672.34E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT NHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SPEEENLIAE LHSVLGNRWS QIAARLPGRT DNEIKNLWNS SIKKKLRQRG  120
IDPNTHKPIS EVDKDKTTAT SNNNNHKSPP SSSSPTNQDF FLERPSDFSD YFGLQKLNFN  180
SNLGLSVTAD SSPLCSMIPS QFSTGNMVGS VFQTPVCVKP SVTLAPDNTS NFFDNGGFSW  240
SGPNSSSSSS LVKPNHNLEE MKWSEYSMNT PFFNRSTLNS QPIYIKSEAE YLADVSNITD  300
PWSQSQNENL NTPEDSDVFS KDLQRMAVSF GQSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667410.0KC966741.1 Brassica napus MYB transcription factor 61 (MYB61.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013584656.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0A7BX180.0A0A0A7BX18_BRANA; MYB transcription factor 61
STRINGBra020016.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-176myb domain protein 61